PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603384.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 307aa    MW: 34920.9 Da    PI: 9.2505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603384.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-072468345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT+ E + + +a + + ++   +W ++a++++ g+t  +++  + 
   XP_009603384.1 24 KWTPAENKAFENALAFFDKDtpdRWQRVAEMVP-GKTVVDVIRQYK 68
                     8********************************.******998886 PP

2Myb_DNA-binding45.12.3e-14135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
   XP_009603384.1 135 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 179
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.6572073IPR017884SANT domain
SMARTSM007172.1E-92173IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-112378IPR009057Homeodomain-like
CDDcd001676.85E-72470No hitNo description
PfamPF002493.2E-62469IPR001005SANT/Myb domain
PROSITE profilePS5129419.663128184IPR017930Myb domain
SuperFamilySSF466897.25E-17129183IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17131183IPR006447Myb domain, plants
SMARTSM007172.9E-12132182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-12133179IPR009057Homeodomain-like
CDDcd001672.70E-11135180No hitNo description
PfamPF002499.9E-13135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEILSPAPYL SNSSWFLDEE KSTKWTPAEN KAFENALAFF DKDTPDRWQR VAEMVPGKTV  60
VDVIRQYKEL EDDVSRIEAG LITIPGYTTT SSSPFTLEWG NSHSSFDGYK QSYVVGGKRS  120
LSNRPPEQER KKGIPWTEEE HKLFLMGLKK YGKGDWRNIS RNFVITRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT INLNDNQTPS PDHQKPTSID QSTVISQQPK SADNAMHKIP  240
FQWSQVNNGF NYAEGSLFVS PPYGGNSYGD IKMQSQSLQQ RGAMREPYFG SQSMNFQLQS  300
AQPYYHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-1625981184RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-141HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603384.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_009603385.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016432478.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-145DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0V0IJC40.0A0A0V0IJC4_SOLCH; Putative transcription factor DIVARICATA-like
TrEMBLM1CZ980.0M1CZ98_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000780290.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-103Homeodomain-like transcriptional regulator